SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000039749 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000039749
Domain Number 1 Region: 246-438
Classification Level Classification E-value
Superfamily Nudix 6.91e-45
Family NADH pyrophosphatase 0.001
Further Details:      
 
Domain Number 2 Region: 15-83
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000366
Family Ankyrin repeat 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000039749   Gene: ENSBTAG00000027728   Transcript: ENSBTAT00000039965
Sequence length 444
Comment pep:known chromosome:UMD3.1:7:105030976:105045004:-1 gene:ENSBTAG00000027728 transcript:ENSBTAT00000039965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVKRSLNQEIISQFHYSAAEGDIAKLTAILSHSPSLLNETSENGWSALICDRSIVNKS
RQTALDIAKFWGYKHIANLLANAKGGKKPWFLTNEVEECENYFSKTLLDRKSEKRNNSDW
LLAKESHPATVYILFSDLNPLVTLGGNKESFQQPEVRLCQLNYTDIKDYLAQPEKITLIF
LGVELEMKKEFFNYAGEISKEEEDGLVAWFALGIDTVAAEEFKQRHENCYFLHPPMPALL
QLKEKEAGVVAQARSVLAWHSRYKFCPTCGNATKIEEGGYKRVCLKEDCPSLHGVHNTSY
PRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPGETIEDAVRREVEEESGVK
VGHVQYVSCQPWPMPSSLMIGCLAVAVSTEIKVDKNEIEDARWFTREQVVDVLTKGKQQA
FFVPPSRAIAHQLIKHWIGMNPNL
Download sequence
Identical sequences Q29RH3
NP_001040073.1.59421 NP_001040073.1.76553 XP_005889873.1.15283 ENSBTAP00000039749 ENSBTAP00000039749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]