SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000040703 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000040703
Domain Number 1 Region: 507-748
Classification Level Classification E-value
Superfamily vWA-like 8.89e-76
Family Trunk domain of Sec23/24 0.00000599
Further Details:      
 
Domain Number 2 Region: 749-841
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.49e-39
Family beta-sandwich domain of Sec23/24 0.0007
Further Details:      
 
Domain Number 3 Region: 950-1098
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.44e-33
Family C-terminal, gelsolin-like domain of Sec23/24 0.0012
Further Details:      
 
Domain Number 4 Region: 281-473
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 5.49e-30
Family beta-sandwich domain of Sec23/24 0.0018
Further Details:      
 
Domain Number 5 Region: 845-946
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 2.48e-25
Family Helical domain of Sec23/24 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000040703   Gene: ENSBTAG00000018322   Transcript: ENSBTAT00000043111
Sequence length 1099
Comment pep:known chromosome:UMD3.1:7:47754927:47832191:1 gene:ENSBTAG00000018322 transcript:ENSBTAT00000043111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPGIPASGGSSTGLQAQNGAASASGSPYTNGPVQNALMSSQVSVSQGYNSQLPGSYPH
LIPAKTLNPVSGQSNSGGSQTVSPLSNYQGPGQALYGPPVASHPVTPSLHSGPSPQMPLP
TSQNPAATPMPSGSFLPGASVSSPSNWQYNYLSQTNHCPRASSQPTMTGNTNLMSPQYVS
SGDSSLQNNIIKSGSALPLVNPPLPTTFQPGAPLGPPPTGGPPPVRALTPQKLTPRTMPQ
PSFNSTSNQEGIISNTNNGSMVVHNNYDEIEGGGFLATSQPTTKNPTMSRSVGYSYPSLP
PGYQNTAPPSTTGAGLPPSSLNYPSGPQAFTQTPLGANHLTSSMSGLSLHPEGLRVINLL
QERNMLPSTPLQPPVPNLHEDIQKLNCNPELFRCTLTSIPQTQALLNKAKLPLGLLLHPF
KDLVQLPVVTSSTIVRCRSCRTYINPFVSFLDQRRWKCNLCYRVNDVPEEFMYNPLTRVY
GEPHRRPEVQNATIEFMAPSEYMLRPPQPPVYLFVFDVSHNAIETGYLNSVCQSLLDNLD
LLPGNTRTKIGFITFDSTIHFYSLQEGLSQPQMLIVSDIEDVFIPMPENLLVNLNESKEL
VQDLLKTLPQMFTKTLETQSALGPALQAAFKLMSPTGGRMSVFQTQLPTLGVGALKPREE
PNQRSSAKEIHLTPSTDFYKKLALDCSGQQVAVDLFLLSGQYSDLASLGCISRYSAGSVY
YYPSYHHQHNPIQVQKLEKELQRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLL
SLPNVNPDAGYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNEV
FLGADVQAISGLLANMAVDRSVTASLSDARDALVNAVIDSLSAYRSSALSNQQPGLMVPF
SLRLFPLFVLALLKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLYRVDNLSD
EGAISINDRTIPQPPILQLSVEKLSRDGAFLMDAGSVLMLWVGRNCGQNFLSQVLGVENY
ALIPQTMTDLPELDTPESARTIAFISWLREQRPFYPILYVIRDESPMKANFLQNMVEDRT
ESALSYYEFLLHIQQQVNK
Download sequence
Identical sequences A6QNT8
ENSBTAP00000040703 9913.ENSBTAP00000040703 NP_001095319.1.59421 NP_001095319.1.76553 ENSBTAP00000040703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]