SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041264 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041264
Domain Number 1 Region: 233-319
Classification Level Classification E-value
Superfamily SH2 domain 4.23e-47
Family SH2 domain 0.00000948
Further Details:      
 
Domain Number 2 Region: 9-146
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 5.49e-41
Family N-terminal domain of cbl (N-cbl) 0.00035
Further Details:      
 
Domain Number 3 Region: 147-232
Classification Level Classification E-value
Superfamily EF-hand 3.06e-37
Family EF-hand modules in multidomain proteins 0.00013
Further Details:      
 
Domain Number 4 Region: 325-403
Classification Level Classification E-value
Superfamily RING/U-box 4.16e-37
Family RING finger domain, C3HC4 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041264   Gene: ENSBTAG00000009494   Transcript: ENSBTAT00000043713
Sequence length 491
Comment pep:known chromosome:UMD3.1:18:52943365:52959011:1 gene:ENSBTAG00000009494 transcript:ENSBTAT00000043713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALRGRQWGESRAFGRAVRLLQRLEEQCGDPRLSSSPPSLRDLLPRTAQLLRQVAQA
RREAGGGVPEGPGGPWDFLMVYLANLEAKSRQVAALLPPHGRKIANDELFREGSRLRRQL
AKLALIFSYMHAELDALFPGGRYCGHTYQLTKVSAHTFWRERCGARCVLPWAEFEAVLCI
CHPVEPGSTALALRSTIDLTCSGHVSIFEFDIFTRLFQPWPTLLKNWQLLAVNHPGYMAF
LTYDEVQARLQTFRDKPGSYIFRPSCTRLGKWAIGYVSSDGSILQTIPLNKPLFQVLLEG
QKEGFYLYPDGKNHNPDLTELCHMEPHQHIHVSEEQLQLYWAMDSTFELCKICAESNKDV
KIEPCGHLLCSRCLAAWLCSDSQTCPFCRCEIKGQEAVSIHQFHVSATVEDPEHSSDEEE
LEQMAPSGPPLPPRLDLCPKSPSSKGHLNVAPPTLPRLRAPLPLPRFWTAASAPWEVTSS
PQAREGARGNS
Download sequence
Identical sequences A6QPZ5
NP_001094718.1.59421 NP_001094718.1.76553 9913.ENSBTAP00000041264 ENSBTAP00000041264 ENSBTAP00000041264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]