SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041587 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041587
Domain Number 1 Region: 64-221
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.96e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000996
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041587   Gene: ENSBTAG00000031145   Transcript: ENSBTAT00000044074
Sequence length 226
Comment pep:known chromosome:UMD3.1:X:132047953:132063581:1 gene:ENSBTAG00000031145 transcript:ENSBTAT00000044074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDRKVVNFNLIFPLLSFCSATLGLSSTEDEGEDPWYHKACKCDCQGGANALWSAGPTPLD
CIPECPYHKPLGFESGEVTPDQITCSNVEQYVGWYSSWTANKARLNSQGFGCAWLSKFQD
SSQWLQIDLKEVKVISGILTQGRCDIDEWMTKYSVQYRTDESLNWIYYKDQTGNNRVFYG
NSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCT
Download sequence
Identical sequences F1MPS1
ENSBTAP00000041587 ENSBTAP00000041587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]