SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000041967 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000041967
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-51
Family Calponin-homology domain, CH-domain 0.00000016
Further Details:      
 
Domain Number 2 Region: 194-254
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.96e-20
Family EB1 dimerisation domain-like 0.0000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000041967   Gene: ENSBTAG00000003908   Transcript: ENSBTAT00000044474
Sequence length 268
Comment pep:known chromosome:UMD3.1:13:62728053:62754549:1 gene:ENSBTAG00000003908 transcript:ENSBTAT00000044474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKK
VKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKEYDPVAARQGQETAMAPSLVAPALNKPKKPLSSSSAAPQRPITTHRTTATPKAGPGVV
RKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENNPVLQ
RIVDILYATDQDFIIXDEGGPQEEQEEY
Download sequence
Identical sequences F1MHV5
ENSBTAP00000041967 ENSBTAP00000041967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]