SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042086 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042086
Domain Number 1 Region: 5-186
Classification Level Classification E-value
Superfamily Nudix 5.96e-28
Family MutT-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042086   Gene: ENSBTAG00000011809   Transcript: ENSBTAT00000044604
Sequence length 210
Comment pep:known chromosome:UMD3.1:29:46123752:46126289:-1 gene:ENSBTAG00000011809 transcript:ENSBTAT00000044604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPDCLSAEGEQRCRRLLAGATARLRARPAAAAVLVPLCSVRGVPALLYTLRSSRLAGRH
KGDVSFPGGKCDPADRDVVHTALRETQEELGMAVPEEQVWGVLRPVHDREKATVVPVLAG
VGPVDPQSLRPNPEEVDEVFALPLAHLLQEQNQGYTHFCRGGHFQYTLPVFLHGPHRVWG
LTAVITEFTLKLLAPGVYQPRLAGPELPRG
Download sequence
Identical sequences A7MBF7
9913.ENSBTAP00000042086 ENSBTAP00000042086 ENSBTAP00000042086 NP_001094725.1.59421 NP_001094725.1.76553 XP_010835981.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]