SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000042244 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000042244
Domain Number 1 Region: 75-169
Classification Level Classification E-value
Superfamily EF-hand 2.09e-18
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000042244   Gene: ENSBTAG00000009048   Transcript: ENSBTAT00000044780
Sequence length 242
Comment pep:known chromosome:UMD3.1:16:53306776:53324889:-1 gene:ENSBTAG00000009048 transcript:ENSBTAT00000044780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATDELASKLSRRLQMEGEGGGEAPEQPGLNGAAAAAAAAGAPDETAEALGSADEELSAK
LLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKEYDAGRDGFIDLMELK
LMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLHVLARLS
EIDVSTEGVKGAKSFFEAKVQAMNVSSRFEEEIKAEQEERKKQAEEMKQRKAAFKELQST
FK
Download sequence
Identical sequences A5D7A0
ENSBTAP00000042244 NP_001096715.1.59421 NP_001096715.1.76553 XP_019832287.1.53367 ENSBTAP00000042244 9913.ENSBTAP00000042244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]