SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043158 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043158
Domain Number 1 Region: 497-527,565-631
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000104
Family Anti-sigma factor antagonist SpoIIaa 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043158   Gene: ENSBTAG00000032301   Transcript: ENSBTAT00000045797
Sequence length 655
Comment pep:known chromosome:UMD3.1:14:75397723:75546727:-1 gene:ENSBTAG00000032301 transcript:ENSBTAT00000045797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGAKRKKKSLPWSKMRIPRCEDFKQWCRRRLPILEWATHYSLKESLLPDTVSGMMLAVQ
QVAQGLAFAVLSSVHPVFGLYGSLFPAIIYAIFGMGRHVATGTFALTSLISANAVERLVP
LSSQNLTTHSNTSVLGLSDFEMQRIGVAAAVSFLGGVIQVAMFVLQLGSATFLITEPVVS
AMTTGAATHVVTSQAKYLLGMKMPHISGPLGFFYIYAYIFKNIKSVQLEALLLSLLSIVV
LVLVKELNEQFKRKIKIVLPVDLVLMIAASFTCYCTDMENTYGLEVVGHIPKGIPPPRAP
PMNILSAVITEAFGVALVGYVASLALAQGSAKKFRYSVDDNQEFLAHGLSNVIASFFFCI
PSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYTIGPLLYWLPMCVLASIIVVGLKGM
LIQFRDLKRYWNVDKIDWGIWVSTYIFTICFAANVGLLFGVVCTTAIVIGRFPRAKTLST
KNMKEMEFKVKTEMDDETLQQVKIISINNPLVFLNAKKFHNDIMNIIQKENIGNQPLDEI
RKYEQSTLVSSLSGVCNEEATQPCLNPKCSLVLDCSGLTFSDYTGVSMLVEVYMDCKNKS
VDVSLVHCTASLIKAMKYCGNLDSEKPIFFESVSAAISNIHLNKNLSILSDHSEI
Download sequence
Identical sequences E1BD54
ENSBTAP00000043158 ENSBTAP00000043158 NP_001180075.1.59421 NP_001180075.1.76553 XP_005215735.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]