SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000043704 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000043704
Domain Number 1 Region: 790-827
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000524
Family HkH motif-containing C2H2 finger 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000043704   Gene: ENSBTAG00000007382   Transcript: ENSBTAT00000046397
Sequence length 1406
Comment pep:known chromosome:UMD3.1:21:32118828:32512606:-1 gene:ENSBTAG00000007382 transcript:ENSBTAT00000046397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKASFQRSNSHDKVRRIVAEEGRTARNLIAWSVPLESKDDDGKSKCQTGGKSKRTIQGTH
KTSKQQNTTVDCKMTSSAAGDKHFDKSPTKTRHPRKVDLRARYWAFLFDNLRRAVDEIYV
TCESDQSVVECKEVLMMLDNYVRDFKALIDWIQLQEKLEKTDAQSRPTSLAWEVKKMSPG
RHVIPSPSTDRINVTSNARRSLNFGGSSGTVAAPRLAPTGVSWADKVKAHHTGSTASSDV
APAPSCPPVAVQKPSRRNERKDAEGWETVQRGRPVRSRSTAVMPKASLPTEALRSKDDSD
KENVHLLPDESIQKSEFVGDEPSNTIESQPKDPVHSCDHPLAERTQFTVSTLDDVKNSGS
SFLPDNSVQTSEIPAVHIDTECVSVIQQADTPSLQASEDKFSAEKARIESEMDPSDISNS
MAEVLAKKEELADRLEKANEEAIASAIAEEEQLTREIEAEENNDINLETDNDSDFSASMG
SGSVSFCGMNWNDVLADYEEIARESWRQNTSWGDIVEEEPARPPGHGIHMHEKLSSPSRK
SNRTIAESKKKHEEKQMKAQQLREKLREQKTLKLQKLLEREKEVRKWKEGLLDQRRRMME
EKLLHAEFKREVQLQAIVKKAQEEEAKVNEIAFINTLEAQNKRHDVLSKLKEYEQRLNEL
QEERQRRQEEKQARDEAVQERKRALEAERQARVEELLMKRKEQEARIEQQRQEKEKARED
AARERARDREERLAALTAAQQEAMEELQKKIQLKHDESIRRHMEQIEQRKEKAAELSSGR
HANTDYAPKLTPYERKKQCSLCNVLISSEVYLFSHIKGKKHQQAVRENSSIQGRELSDEE
VEHLSLKKYVIDIVVESTAPPEPSKDGEERQKNKKKAKKIKARMNFRAKEYESLLEAKNS
GSDSPYKAKLQRLAKDLLKQLQVQDGGSWANNKVSALDRTLGEVARILEKENVADQIAFQ
AAGGLTALEHILQVVVPVTNVNTVSRIPPKSLCNAINVYNLTCNNCSENCTDVLFSNKIT
FLMDLLIHQLTVYVPDENNAILGRNTNKQVFEGLTTGLLKVSAAVFGCLIANRPDGNSQP
TTPKISTQEMKSKPSQGDAFNSRVQDLISYVVNIGLIDKLCGCFLSVQGPVDENPKMAAF
LQHAAGLLQGMCTLCFAVTGRSYSIFDDNRQDPTGLAAALQATDLAGVLHMLYCVLFHGT
ISDPSTASPKESYAQSTVQVAIQSLRFFNSFAVLDLPAFQSIVGAEGLSLAFRHIASSLL
GHCSLVSCESLLHEVIVCVGYFTVSHPDNQVIVQSGRHPTVLQKLCQLPFQYFSDPRLIK
VLFPSLIAACYNNLQNKVILEQEMSCVLLATFIQDFAQTSGQADNQSYQPKGMSLLKLND
YLELANRFPQQAWEEARQFFFKKEKK
Download sequence
Identical sequences F1MRU6
ENSBTAP00000043704 ENSBTAP00000043704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]