SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044096 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044096
Domain Number 1 Region: 5-99
Classification Level Classification E-value
Superfamily EF-hand 6.41e-23
Family S100 proteins 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044096   Gene: ENSBTAG00000006505   Transcript: ENSBTAT00000046849
Sequence length 156
Comment pep:known chromosome:UMD3.1:3:17176310:17179005:-1 gene:ENSBTAG00000006505 transcript:ENSBTAT00000046849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDKMSQMESSIETIINIFHQYSVRLGHYDTLIQKEFKQLVQKELPNFLKKQKKNEAAIN
EIMEDLDTNVDKQLSFEEFIMLVARLTVASHEEMHNTAPPGPGHRHGPGYGKGGSGSCSG
QGSPDQGSHDQGSHGHGHGHSHGGHGHSHGGHGHSH
Download sequence
Identical sequences F1MHS5
XP_005203785.1.76553 XP_005203786.1.76553 XP_005203787.1.76553 ENSBTAP00000008523 ENSBTAP00000044096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]