SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044542 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044542
Domain Number 1 Region: 57-336
Classification Level Classification E-value
Superfamily L domain-like 9.52e-56
Family Ngr ectodomain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 266-554
Classification Level Classification E-value
Superfamily L domain-like 2.55e-54
Family Ngr ectodomain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044542   Gene: ENSBTAG00000033299   Transcript: ENSBTAT00000047326
Sequence length 610
Comment pep:known chromosome:UMD3.1:25:1366647:1368479:-1 gene:ENSBTAG00000033299 transcript:ENSBTAT00000047326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APPQAPLPAGVPALVVLLVSWAALGPHGLEGVEPVAPADPEGLQCPAVCSCGHDDFTDEL
SVFCSSRNLTQLPGGLPPGTRALWLDGNNFSSIPAAAFRNLSGLGFLNLQGSGLASLEPQ
ALLGLRGLCHLHLEHNRLHALAAHTFLHTPGLASLGLSNNLLSRLDEGLFRGLAHLWDLN
LGWNSLTVLPDTAFQGLAGLRELVLAGNKLAYLQPPLFCGLGELRELDLSRNTLRSVKAN
VFVKLPKLQKLYLDHNLVAAVAPGAFLGMKALRWLDLSHNRVGSLLEDSFPGLLGLHVLR
LSHNVLAGLRPRTFKDLHFLEELQLGHNRLRQLPEEAFAGLGQLEVLALNDNQLQELRPG
GFLGLRNLAVLNLSSNCLRDLPERAFQGLAKLHSLHLEGGCLARLGPLAFAGLSGLRRLF
LKGNSIADVDERSLGGLAELLELDLTANQLTHLPGRLFQDLGRLEYLLLARNRLSALPAD
ALGPLQRTFWLDVSHNRLEALPAAALAPLSRLRFLSLRNNSLRTFAPQPPGLERLWLEGN
PWDCGCALGALRAFALQQPASVPRFVQALAEGNDDRQPPVLAYNNITCASPPSLAGLDLR
DVGEAHFAHC
Download sequence
Identical sequences F1MJZ4
ENSBTAP00000044542 ENSBTAP00000044542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]