SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000044870 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000044870
Domain Number 1 Region: 168-239
Classification Level Classification E-value
Superfamily Homeodomain-like 1.5e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 30-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000599
Family LIM domain 0.009
Further Details:      
 
Domain Number 3 Region: 2-29
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000407
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000044870
Domain Number - Region: 91-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0357
Family LIM domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000044870   Gene: ENSBTAG00000033562   Transcript: ENSBTAT00000047689
Sequence length 406
Comment pep:known chromosome:UMD3.1:19:13611604:13617403:1 gene:ENSBTAG00000033562 transcript:ENSBTAT00000047689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFG
TKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLS
NSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEGGSNENDDQNLGAKR
RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLVDRLEPGELLPNGPFSFYGDYQSEYYGPGGNYDFFPQGP
PSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPS
LPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEMNEAAVW
Download sequence
Identical sequences A7Z015 G1PQP4 L8IIZ5
NP_001098917.1.59421 NP_001098917.1.76553 XP_005897042.1.15283 XP_005982226.1.78601 XP_006092313.1.53796 XP_008147731.1.99482 XP_010859854.1.44457 XP_011969897.1.54773 ENSMLUP00000013419 ENSBTAP00000044870 ENSMLUP00000013419 9913.ENSBTAP00000044870 9913.ENSBTAP00000045678 ENSBTAP00000044870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]