SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000045836 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000045836
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 4.71e-40
Family Rap30/74 interaction domains 0.000000538
Further Details:      
 
Domain Number 2 Region: 175-242
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.25e-23
Family DNA-binding domain from rap30 0.0000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000045836   Gene: ENSBTAG00000034495   Transcript: ENSBTAT00000048870
Sequence length 249
Comment pep:known chromosome:UMD3.1:12:15329215:15465651:1 gene:ENSBTAG00000034495 transcript:ENSBTAT00000048870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKAPGRGEVGKLRIAKNQGRTEVSFTLNE
DLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAA
NENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADK
QHVLDMLFSAFEKHQYYNLKDLVDITKQPVSYLKDILKEIGVQNVKGIHKNTWELKPEYR
HYQVEEKSD
Download sequence
Identical sequences Q2T9L9 W5PCK0
ENSBTAP00000045836 ENSOARP00000008162 9913.ENSBTAP00000045836 ENSBTAP00000045836 NP_001033153.1.59421 NP_001033153.1.76553 XP_004012106.1.66739 XP_005687487.1.57651 XP_005968071.1.78601 XP_006053450.1.26621 XP_012017581.1.54773 XP_019826792.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]