SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000046934 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000046934
Domain Number 1 Region: 1-225
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.08e-67
Family Eukaryotic proteases 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000046934   Gene: ENSBTAG00000035709   Transcript: ENSBTAT00000050193
Sequence length 265
Comment pep:known chromosome:UMD3.1:8:66018697:66030285:1 gene:ENSBTAG00000035709 transcript:ENSBTAT00000050193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QASLRFQGSNICGAVLINSSWLLSTAHCFLKKSKAPENYQVLLGSIQLYQHTPQTQEISV
SRIITHPDFEKLHPFGSDIAMLQLLFPVNFTSYIIPACLPVPGMKLPSNSSCWIPGWGML
NEESERGHNLLQEGKVSFVENKFCNMLYGLAKGKNVSVQEDMLCAGDFSTGTSICLGDSG
GPLVCDFTSSWVLMGLASWGFDCRHPIYPSIFTNITYFTDWIEEIQRLTPNPEPTSALTP
LPKPTSTPPQTQFPHQSLRAALVCA
Download sequence
Identical sequences E1BFA2
ENSBTAP00000046934 ENSBTAP00000046934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]