SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000047379 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000047379
Domain Number - Region: 108-154
Classification Level Classification E-value
Superfamily EF-hand 0.00129
Family Calmodulin-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000047379   Gene: ENSBTAG00000036222   Transcript: ENSBTAT00000050712
Sequence length 1265
Comment pep:known chromosome:UMD3.1:13:17742133:17783203:1 gene:ENSBTAG00000036222 transcript:ENSBTAT00000050712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVPPKCVSSSKWYGRQSQPKPCGAAGGAPGLLEQPAIPSARSQLRGSASLESVESLKSDE
EANSAKEPQNELFEAQGQLPTWGSEVFGSRKPCSHSFDTPESQVWGLWEELGVGISGHLP
EQELALVCQSIGLQGLVKEEPEDLFNKLDQDGDGRVLEELQLGLFNHGSPRPLELAPLVK
PSRSWSRYQVPEESVGQTTTSSLVSVCSGPRLFCSVDDGSGFAFLEQIISFGAQEGVHNG
REVLQSLDFSVDEKVNLLELTWALENELMMVGGAAQQAALACYRQDLSFCQEQVEQMVRE
RDKARQDLEKAEQRNLEFVKETDDLHSAREQLTEEKVRHLEQSYRGRLSLLRSEVEVERE
LFWEEARRQRAGLEEDLRKRLQAKETGLHEKLTLALKEMTEVVEKLSDSEKLVLKLQNDL
EFVLRDKLEPQSTELLAQEERFSEILKEYELKYRDLQDHSDKLQAALESLQAQAAPSRHG
RLPPGHGRGTVTFVGDSAPASIETEIMLEQVKEHYQDPAGDQGQGTEVNDHEREMEETKR
AFAEERRELERAFQLEVGVLQGQKAKLVMLQAESQEVVQGLRQQLQRRVERPPPWPCVIS
GPGFVAQNPDLKLNLGNRLLRVTSSEESDFKNTVSFICHLVAPGEVDKRHKCPQIMGKAF
SLETEICEQRRALPGASQHHPGDDLGDCRQAQLEKENTGIASSPRLCSQTPLPSPRGAWT
VCERVDPLLQLRLRSKAGLGPSAPGVHIRPLAHSGPSVREQPSGHMPSLPSVSGTSSGLA
QEPVLSSSSTQPPGPGAVLGLSPLLLTRGTPWLVGPTANVTVPVSVVSGSLDRVSSFGPR
WVGGEGSILGHLCRPPILDPYLPPLTPAVTGWSSSCSILTPSLLPALPQGDLLHLLWFFF
VTVTLRATPSLCCLMLTGAKKALFFCSLSLGRCKPEQVNTGYREGLVPCVPIQGRNLLSR
IELEKLSEENTLLKNELGRIRQEFEASERTEAAQRKEIEVLKRDKEKACSEMEELCTQSQ
KCRDELSQLNHRVLQLGEEASTHQTQSEKSPVTVQLLTHGLEEAELREELQGNQIQKLEL
DRVTQDHQSLRLAQSQLREALEESGPGLYGATQRLQLARLQHAQQVRQLREEMAQLVPAV
RVAELQRLLEGERRGAWWLQAEAQEAHEKQLKATEEWVEEVETILKNMEVLLQEKVGELK
EQFEKNTRSDLLLKELYVENAHLTKALQVTEEKQRGAEKKSQFLEEKLRALNKLLSKIAT
ASLAV
Download sequence
Identical sequences G5E649
ENSBTAP00000047379 ENSBTAP00000047379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]