SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000048918 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000048918
Domain Number 1 Region: 114-272,314-476
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.69e-61
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000963
Further Details:      
 
Domain Number 2 Region: 38-121
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000493
Family Anticodon-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000048918   Gene: ENSBTAG00000039943   Transcript: ENSBTAT00000056422
Sequence length 478
Comment pep:known chromosome:UMD3.1:29:17544439:17627915:1 gene:ENSBTAG00000039943 transcript:ENSBTAT00000056422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRARCLLRALRSCSSAPCPRQRPAARVSVRGALGVQSANGERVKVQGWIRSIRSQKEVL
FLHVNDGSSLESLQVVADSSFDSRELAFGSSVEVQGQLVKSPSKKQNVELKAEKIEVVGS
CDAKAFPFKYKERHPLEYLRQYPHLRCRTNVLGSVLRVRSEATAAIHSFFKDSGFVHIHT
PVITSNDCEGAGELFQVEPSSKIKVPEENFFNIPVFLTVSGQLHLEVMSGYFTKKCNFGN
MKKSVRSQSPLILASLQISGNAISFFLEIKQENLYYLNLIFCIPVLPILNPPPSSLPIPS
LWVVPVHQPQASSIMRRTWTGISYTEAVEILKQASQNFTFTPEWGADLHTEHEKYLVKHC
GDIPVFVINYPLVLKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGSLREERYHLLEQRL
ARLGLTEAYQWYLDLRRFGSVPHGGFGMGFERYLQCILGIDNIKDVIPFPRFTHSCLL
Download sequence
Identical sequences F6QRZ3
ENSBTAP00000048918 ENSBTAP00000048918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]