SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000049395 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000049395
Domain Number 1 Region: 299-617
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.01e-128
Family Mammalian PLC 0.0000000000488
Further Details:      
 
Domain Number 2 Region: 139-295
Classification Level Classification E-value
Superfamily EF-hand 6.08e-47
Family EF-hand modules in multidomain proteins 0.000000698
Further Details:      
 
Domain Number 3 Region: 629-754
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.49e-31
Family PLC-like (P variant) 0.00000388
Further Details:      
 
Domain Number 4 Region: 15-129
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-28
Family Pleckstrin-homology domain (PH domain) 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000049395   Gene: ENSBTAG00000037726   Transcript: ENSBTAT00000052073
Sequence length 756
Comment pep:known chromosome:UMD3.1:22:11497086:11518465:-1 gene:ENSBTAG00000037726 transcript:ENSBTAT00000052073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSGRDFLTLHGLQDDKDLQALLKGGQLLKVKSNSWRRERFYKLQEDCKTIWQESRKVMR
TPESQLFSIEDIQEVRMGHRTEGLEKFARDVPENRCFSIVFKDQRNTLDLIAPSPADAQH
WVQGLGKIIHHSGSMDQQQKLRHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSY
ARKIFKECDHSQTDSLEDEEIETFYKILTQRKEIDRTFEEATGSKETLSVDQLVTFLQHQ
QREEEAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFDLAHRRVYQDMDQ
PLSHYLVSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTF
TSKILFCDVVRAIRDYAFKASPYPVILSLENHCSLEQQRVMARHLRTLLGPMLLDRPLDG
VVTSLPSPEQLRGKILLKGKKLGGLFPPGGEGGPEATVVSDEDEAAEMEDEAVRSQVQHK
SKEDKLRLAKELSDMVIYCKSVHFRGFPSSGTSGQAFYEMSSFSENRALRLLQESGNSFV
RHNVNHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGSEMDVYQGRFLDNGACG
YVLKPAFLRDPNSTFNSRALAHGPWWTPKRLNVRVISGQQLPKVNKNKNSIVDPKVTVEI
HGVSRDVASRQTAVVTNNGFNPWWDTELEFEVAVPELALVRFVVEDYDASSKNDFIGQST
IPLKSLKQGYRHIHLLSKNGDQHPSATLFVKVALQD
Download sequence
Identical sequences P10895
ENSBTAP00000049395 ENSBTAP00000049395 9913.ENSBTAP00000049395 NP_001075045.1.59421 NP_001075045.1.76553 XP_019840557.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]