SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051139 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051139
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily POZ domain 1.26e-27
Family BTB/POZ domain 0.00071
Further Details:      
 
Domain Number 2 Region: 414-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000137
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051139   Gene: ENSBTAG00000021329   Transcript: ENSBTAT00000028434
Sequence length 513
Comment pep:known chromosome:UMD3.1:29:41754017:41755558:-1 gene:ENSBTAG00000021329 transcript:ENSBTAT00000028434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPEHSQQLLQSLREQRSQGFLCDCTVMVGSTQFLAHRAVLASCSPFFQLFYKERELDK
RDLVCIHNEIVTAPAFGLLLDFMYAGQLVLRGDTPVEDVLAAASYLHMNDIVKVCKRRLQ
ARGLAEADSTKKEEETNSQPPNLEFLSSTSRGSQPSLASAETSGPWGKGEWKGSAAPSPI
CPPDEPPMPAGADTTQPGVEVESSHLQAPPVPVADVSLASPSSSTETNPANYFSAGLPTV
SVEPLAPLDVGSESLRVVEPRATGGPLQGFYPPTSAAVPVPSEAPAPAEAELVQVKVEAI
VISDEEPDVSEEQPRGPEGLFPPGGAMYGGQPPQPEAFEEPRAAGLEEVGPSDHFLPPDP
HLPYHLLPGPGQYHRGLVTSPLPAPPALHEPLYLPSEYETAPGSFGGFTEDVPTCKTCGK
TFSCSYTLRRHATVHTRERPYECRYCLRSYTQSGDLYRHIRKAHNEDLAKRSKPDPEAGP
VLGAQPLPGSPTADRQNSSVGGPPKDFVLGSKN
Download sequence
Identical sequences F1MXA9
ENSBTAP00000051139 ENSBTAP00000051139 XP_003584307.3.59421 XP_003588087.3.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]