SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000051299 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000051299
Domain Number 1 Region: 21-156
Classification Level Classification E-value
Superfamily SNARE-like 2.11e-29
Family Clathrin coat assembly domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000051299   Gene: ENSBTAG00000039954   Transcript: ENSBTAT00000056479
Sequence length 185
Comment pep:known chromosome:UMD3.1:19:39081066:39090187:1 gene:ENSBTAG00000039954 transcript:ENSBTAT00000056479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGSAGPPRRRADLQEPSLYTIKAVFILDNDGHRLLAKYYDDTFPSMKEQMAFEKNVFNKT
SRTDSEIAFFGGMTIVYKSSIDLFLYVVGSSYENELMLMSVLTCLFESLNHVLRKNVEKR
WLLENMDGAFLVVDEIVDGGVILESDPQQVIQKVNFRADDSGLTEHSVAQVLQSAKEQIK
WSLLK
Download sequence
Identical sequences F1MXE6
ENSBTAP00000051299 ENSBTAP00000051299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]