SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052019 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052019
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily EF-hand 2.08e-18
Family Calbindin D9K 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052019   Gene: ENSBTAG00000039260   Transcript: ENSBTAT00000056701
Sequence length 1050
Comment pep:known chromosome:UMD3.1:3:18623659:18628095:1 gene:ENSBTAG00000039260 transcript:ENSBTAT00000056701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTELLNSILTVIRVFQKYAKENGDSTSLCKEELKQLLLAEFGDILRRPNDPETVETILSL
LDRNRNEHVDFHEYLLMVFQLAQACYHRLDNESYGDRTSQQERKQEGTQGHTFPTNTGRQ
HRKRHEGERQDSCHSQSEKQSQDTHQDQSERQDRDSRYSQSERLDRDSHYGQSEGQDRDS
HYGQTERQGQDSSSGQRLSNKSGSGNPERQGYVFALNQYEKQLQDSHCGQSDRLGQQSSY
GQSGRLREDPQYSHTNQQESGSYNEQSGRLGQESGYGQRNRQELESHYGQTDRQGLSTHC
SQTRPDRQGQSYHYGQTDRQGQSSHYGQTDRQGLSSQYGQTDRQGLSSHYGQTDRQGLSS
QYGQTDRQGLSSHYGQMDRQGQRSHYDQTDRQGLSSQYGQMDRQGLSSHYGQTDRQGLSS
QYGRMDRQGQRSHYDQTDRQGLSSQYGQTDRQGQSSHYDETDRQGLSSHYGQTDRQGLSS
QYGQTDRQGQSSHYDETDRQDLSSHYGQTDRQGLSSQYGQTDRQGQSSHYDETDRQGLSS
HYGQTDRQGLSSQYGQTDRQGQSCHYDETDRQGLSSHYGQTDRQGLSSQYGQTDRQGQSS
HYDETDGQGLSSHYGQTDRQGLSSQYGQTDRQGQSCHYDETDRQDLSSHYGQTDRQGLSS
QYGQTDRQGQSFHYDETDRQGLSSHYGQTDRQGQRSHYDQTDRQGLSSHYGQTDRQGLSS
QYGQTDRQGLSSHYGQTDRQGQSSHYDETDRHGLSTRYSQTDRQGVNSQYGQSETGETRQ
NRCFQGSEGASRDSHVEQSGRPGRPSQYTQGQEVNRNQGQRFQTREGQQNSRQAWESEED
SQHKLVAQIQQERPPCHSGRDWQSHSGEQGHRQETPRETWDRETHEDKQTPQRRDRQTHE
DQQTGQRQDRQTHEDEQTRQRRDRQTHKDEQTHEDEQTRQRQDRQTHEEDQNRRQQQDWQ
THKDKERYQESQYRQSHGTQEGCANREKFHMNEDGQSPSSQGRCSDLAFHPTQNAGRPQR
REQGGSHPIKATIAPNPLYDYVQEQKGVWH
Download sequence
Identical sequences E1B971
ENSBTAP00000052019 ENSBTAP00000052019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]