SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000052724 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000052724
Domain Number 1 Region: 52-148,182-430
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.76e-56
Family Myotubularin-like phosphatases 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000052724   Gene: ENSBTAG00000009765   Transcript: ENSBTAT00000052053
Sequence length 597
Comment pep:known chromosome:UMD3.1:22:17052209:17096797:-1 gene:ENSBTAG00000009765 transcript:ENSBTAT00000052053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGARAAAAASAGSSASSGSPQPQEPGLGELLEEFSRTQYRAKDCSGTGGSKVERIEKRC
LELFGRDYCYSVIQNVNGDICGHYPQHIVFLEYESSEKEKDTFQSTVQVSKLQDLVNRSK
TARCRGRFVCPVILFKGKHICRSATLAGWGELYGRTGYNYIFSGGADDAWADAEDLTEED
CALRSSDTHLFDKVRGYDIKLLRYLSVKYICDLMVENKKVKFGMNVTSSEKVDKAQRYAD
FTLLSIPYPGCEFFKEYKDRDYMAEGLIFNWKQDYVDAPLSIPDFLTCSLNIDWSQYQSW
DLVQQTQNYLKLLLSIINNDDDSGLLVHCISGWDRTPLFISLLRLSLWADGLIHTSLKPA
EILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHIISEEFSALKTQRRKSLPARDA
GFTVEDICMLRRKDRGSTTSLGSDFSLVMESSPGAAGSFTYETVELVPAGSQTQAAWRKS
HSSSPQSMLWNRPQPSEDRLPPHQGLVEAKSSSSSSSNHSDNFFRMGSSPLEVPKPRLTA
LSERETRLQEVRSAFLAAYSSTVGLRAAAPSPSGAIGGLLEQFVRGVGLRGTSSSTL
Download sequence
Identical sequences A6QLE9
NP_001093834.1.59421 NP_001093834.1.76553 ENSBTAP00000052724 ENSBTAP00000052724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]