SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000053479 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000053479
Domain Number 1 Region: 228-384
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.35e-31
Family AlaX-like 0.018
Further Details:      
 
Domain Number 2 Region: 4-132
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.59e-29
Family Co-chaperone p23-like 0.00011
Further Details:      
 
Domain Number 3 Region: 170-227
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000282
Family AlaX-M N-terminal domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000053479   Gene: ENSBTAG00000015136   Transcript: ENSBTAT00000061242
Sequence length 543
Comment pep:known chromosome:UMD3.1:19:43635376:43652813:-1 gene:ENSBTAG00000015136 transcript:ENSBTAT00000061242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFRQHARTLWYDRPKYVFMEFCVEDSTDVHVLIEDHRIVFSCKNPDGVEFYNEIEFYAKV
NCKDSQDKRSGRSITCFVRKWKEKVAWPRLTKEDIKPVWLSVDFDNWRDWEGEEEVELAQ
VEHYAELLKKVSTKGPPPAMDDLDFTTTVVSCRPAELHTEESNGKKEVLSGFQVVLEDTL
LFPEGGGQPDDRGTINDISVLRVTRRGTQADHFTQTPLTPGTEVQVRVDWERRFDHMQQH
SGQHLITAVADDLFGLKTTSWELGRLRSVIELDSPTVTAEQVAAIERSVNEKIRDRLPVN
VRELSLDDPEVEQVRGRGLPDDHAGPIRVVTIQSVDSNMCCGTHVSNLSDLQVIKILGTE
KGKKNKTNLIFLAGNRVLKWMERSHGIEKALTALLKCGAEDHVEAVKKLQNSSKLLQKNN
LNLLRDLAVHIAHSLRNSPDWGGVITLHRKDGDSEFMNIIANEIGSEETLLFLTVGDEKG
AGLFLLAGPAEAVETLGPRVSEVLEGKGAGKKGRFQGKATKMSRRAEVQALLQDYISTQS
AEE
Download sequence
Identical sequences E1BP20
ENSBTAP00000053479 ENSBTAP00000053479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]