SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000054556 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000054556
Domain Number 1 Region: 92-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 33-91
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-18
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 3 Region: 139-168
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000115
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000054556   Gene: ENSBTAG00000048023   Transcript: ENSBTAT00000064671
Sequence length 168
Comment pep:known chromosome:UMD3.1:15:43731788:43735570:1 gene:ENSBTAG00000048023 transcript:ENSBTAT00000064671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVLQGHATRVTAKSQQSGEKAFRCGYDGCGKLYTTAHHLKVHERSHTGDRPYQCEHAGCG
KAFATGYGLKSHVRTHTGEKPYRCSEDNCTKSFKTSGDLQKHIRTHTGERPFKCHFEGCG
RSFTTSNIRKVHIRTHTGERPYYCTEPGCGRAFASATNYKNHVRIHTG
Download sequence
Identical sequences G3MYC4
ENSBTAP00000054556 ENSBTAP00000054556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]