SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000055327 from Bos taurus 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000055327
Domain Number 1 Region: 257-323
Classification Level Classification E-value
Superfamily Homeodomain-like 3.38e-20
Family Homeodomain 0.0023
Further Details:      
 
Domain Number 2 Region: 79-147
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000214
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 47-78
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000286
Family LIM domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000055327   Gene: ENSBTAG00000010990   Transcript: ENSBTAT00000065104
Sequence length 427
Comment pep:known chromosome:UMD3.1:11:95125308:95145048:1 gene:ENSBTAG00000010990 transcript:ENSBTAT00000065104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKI
SDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHL
GISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAH
FNHADVAAAAAAAAAAKSAGLGAAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAY
NAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA
QKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKSTEAALQTGTPSGPASELSNASLSP
SSTPTTLTDLTSPTLPTVTSVLTSVPGNLETSLTAPRKRLLPTFSNDSPPPPLPPPHNFF
KKEIIFS
Download sequence
Identical sequences G3N0G6
ENSBTAP00000055327 ENSBTAP00000055327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]