SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397678152|ref|YP_006519688.1| from Mycoplasma wenyonii str. Massachusetts

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397678152|ref|YP_006519688.1|
Domain Number 1 Region: 176-698
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 6.1e-162
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0000000028
Further Details:      
 
Domain Number 2 Region: 24-173
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 1.02e-27
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397678152|ref|YP_006519688.1|
Sequence length 709
Comment ribonucleotide-diphosphate reductase subunit alpha [Mycoplasma wenyonii str. Massachusetts]
Sequence
MINKSQKITNPSYYNSLIFNNQVTLKGEDGFFCLEKDKLAIQEYQKYISECEKYSHKRRG
FERIKWLIETEYYLSQLIEKYSETQINQLTEEVYGAGFQWKSYISISKFFESFALRSNCG
KYILESYEDRVIVTSLFLADGDFELARKIANLIIKQIYQPATPTFSNAGKKRSGMLVSCF
LLEAEDSINSINYIISTSMQLSKIGGGVAINLSKLRGRGASIKQIDSTASGIFPVLKILE
NVFDYADQLGMRRGSGAVYLNIFHYDLIDFIDCKKINADEKSRIQTLSIGLIVPDKFLQL
ATENKNFFIFEPNTIYQKYRLSLPDLDFNYWYDILANDDSLLKKELSARAVLTKIAQIQF
ESGYPYVIFIDNANKKNPLKNIGKIKMSNLCTEIFQNQESSTIGDYGLGDIIRNDVSCNL
ASLNLVNVFEDGNLEEIADLSMRALSAVSDLTSITNAPSIRKANEEFKSVGLGVLNFTGL
LLKNGLEYDSPETLEIADVFFAALNYYSLLASSRIAQERKISFKEFENTDYFTGAYFEKY
ISHPYLPKSEKAKEIFKNMKLPTPEDWANLKELVKKNGIYNAYRLAVAPTQSISYLQGAT
ASIQPIISPIETRMYGSSITYFPMPFLNKDNHHLYKSAYLIDQKKLIDLSAIIQQHVDQG
ISTVLYVTNNSTTRDLVKLYLYAHHKGLKSLYYVRTKNLQPTECVSCQA
Download sequence
Identical sequences I6YM36
gi|397678152|ref|YP_006519688.1| WP_014850068.1.71021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]