SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000000076 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000000076
Domain Number 1 Region: 2-44
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000132
Family Spectrin repeat 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000000076   Gene: ENSCSAVG00000000033   Transcript: ENSCSAVT00000000077
Sequence length 95
Comment pep:known reftig:CSAV2.0:reftig_219:199028:204710:-1 gene:ENSCSAVG00000000033 transcript:ENSCSAVT00000000077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGVQRKLDDFRDYRAKQKPPKIDEKGHLEAAYNTLQTKLIIASVVCPAIPAPTRHLTPS
ITQASPPRCTASRISKSPIKEDNFESNQILLAVYI
Download sequence
Identical sequences H2Y428
ENSCSAVP00000000076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]