SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000000080 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000000080
Domain Number 1 Region: 47-169
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-34
Family Spectrin repeat 0.00000218
Further Details:      
 
Domain Number 2 Region: 283-403
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-23
Family Spectrin repeat 0.0000178
Further Details:      
 
Domain Number 3 Region: 170-279
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-23
Family Spectrin repeat 0.00000644
Further Details:      
 
Domain Number 4 Region: 513-640
Classification Level Classification E-value
Superfamily EF-hand 1.49e-21
Family Calmodulin-like 0.042
Further Details:      
 
Domain Number 5 Region: 409-520
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000144
Family Spectrin repeat 0.0000773
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000000080
Domain Number - Region: 2-32
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000113
Family Calponin-homology domain, CH-domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000000080   Gene: ENSCSAVG00000000033   Transcript: ENSCSAVT00000000081
Sequence length 668
Comment pep:known reftig:CSAV2.0:reftig_219:199342:207158:-1 gene:ENSCSAVG00000000033 transcript:ENSCSAVT00000000081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDAQDIVDMVKPDERSIMTYVAAFYHAFSGNDKAETAANRILKVLGVNQENERLMDEYE
RLASDLLEWIARMKPWLDDRTTDNTMEGVQRKLDDFRDYRAKQKPPKIDEKGHLEAAYNT
LQTKLRLSNRPAFMPSEGKLVSDITSAWKGLEGAEKGYEEWLLAEMRRLERLDHLAKKFY
YKAGIHEKWTVGQEENLASEEYKRASLQELKALMKKHEAFESDLAAHQDRVEQIAAIAQE
LNDLDYHDTETINDRCRDICDEWDRLGSATQKRRTALENMEQILESIEQQHLEFAKRAAP
FNNWMDCAKEDLEDMFIVHSMLEIRKLISAHGVFKDTLPDAQKEKESIIALVQNIKKIQR
QYDLPDESCENAYTTVTPEEIESKWNVVRNMVPARDASLQAELGKQQNHELLRTEFAQIA
NQFGPWMVEFTKEINRIAMSMVGSLEDVKNSLMDYQQRMMANKPQLDTLEKKHQQMQEAL
VFDNPHSAYSMESLHASWEHIKALLSLTINEVENQILMRDAKGLTQEQMNEFRASFNHFD
RKRKGCLEPDDFAAVLISMGYRLGEAEFQRIMALVDPSGTNTVTFQSFIEFMTRESTDSD
TAEQVVESFRILAGDKPYITADELRRELPPDQADYCISRMSRYSSSDAPPDALDYASFST
ALYGESDL
Download sequence
Identical sequences H2Y432
ENSCSAVP00000000080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]