SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000000081 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000000081
Domain Number 1 Region: 12-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-63
Family Calponin-homology domain, CH-domain 0.000063
Further Details:      
 
Domain Number 2 Region: 333-455
Classification Level Classification E-value
Superfamily Spectrin repeat 7.19e-33
Family Spectrin repeat 0.00000218
Further Details:      
 
Domain Number 3 Region: 576-696
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-23
Family Spectrin repeat 0.0000178
Further Details:      
 
Domain Number 4 Region: 456-565
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-23
Family Spectrin repeat 0.00000644
Further Details:      
 
Domain Number 5 Region: 702-813
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000209
Family Spectrin repeat 0.0000773
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000000081
Domain Number - Region: 295-315
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000699
Family Calponin-homology domain, CH-domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000000081   Gene: ENSCSAVG00000000033   Transcript: ENSCSAVT00000000082
Sequence length 834
Comment pep:known reftig:CSAV2.0:reftig_219:199852:212401:-1 gene:ENSCSAVG00000000033 transcript:ENSCSAVT00000000082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDYMTQEDGWEREGLLDPAWERQQRKTFTAWCNSHLRKAGTQIEEIDEDFRNGLKLMLL
LEVISGEHLPRPDRGKMRLHKIANVNKALNFIASKGVRLVSIGAEEIVDGNTKMTLGMIW
TIISICHSGHFSGRVVGQGGFAIMVPEEDGSVQERECSKLPHEVSMAELSSDGLRELVVW
KDGLAFCALIHRHRPDLIDYNKLRKVRIDDPLTNLQTAFEVAEKHLDIPQMLDAQELQDM
AKPDERAVMTYVSCFYHAFSGAQKVVSFFHLSALRKYVIYKITLQTLFKENDIVDMVKPD
ERSIMTYVAAFYHAFSGNDKAETAANRILKVLGVNQENERLMDEYERLASDLLEWIARMK
PWLDDRTTDNTMEGVQRKLDDFRDYRAKQKPPKIDEKGHLEAAYNTLQTKLRLSNRPAFM
PSEGKLVSDITSAWKGLEGAEKGYEEWLLAEMRRLERLDHLAKKFYYKAGIHEKWTVGQE
ENLASEEYKRASLQELKALMKKHEAFESDLAAHQDRVEQIAAIAQELNDLDYHDTETIND
RCRDICDEWDRLGSATQKRRTALEVCVTSCLNMEQILESIEQQHLEFAKRAAPFNNWMDC
AKEDLEDMFIVHSMLEIRKLISAHGVFKDTLPDAQKEKESIIALVQNIKKIQRQYDLPDE
SCENAYTTVTPEEIESKWNVVRNMVPARDASLQAELGKQQNHELLRTEFAQIANQFGPWM
VEFTKEINRIAMSMVGSLEDVKNSLMDYQQRMMANKPQLDTLEKKHQQMQEALVFDNPHS
AYSMESLHASWEHIKALLSLTINEVENQILMRDAKGLTQEQMNEFRASFNHFDR
Download sequence
Identical sequences H2Y433
ENSCSAVP00000000081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]