SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000000082 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000000082
Domain Number 1 Region: 12-241
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.06e-82
Family Calponin-homology domain, CH-domain 0.0000212
Further Details:      
 
Domain Number 2 Region: 272-394
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-34
Family Spectrin repeat 0.00000218
Further Details:      
 
Domain Number 3 Region: 395-504
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-23
Family Spectrin repeat 0.00000644
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000000082
Domain Number - Region: 508-531
Classification Level Classification E-value
Superfamily Spectrin repeat 0.095
Family Spectrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000000082   Gene: ENSCSAVG00000000033   Transcript: ENSCSAVT00000000083
Sequence length 535
Comment pep:known reftig:CSAV2.0:reftig_219:203188:212401:-1 gene:ENSCSAVG00000000033 transcript:ENSCSAVT00000000083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDYMTQEDGWEREGLLDPAWERQQRKTFTAWCNSHLRKAGTQIEEIDEDFRNGLKLMLL
LEVISGEHLPRPDRGKMRLHKIANVNKALNFIASKGVRLVSIGAEEIVDGNTKMTLGMIW
TIILRFAIQDISVEESSAKEGLLLWCQRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRP
DLIDYNKLRKDDPLTNLQTAFEVAEKHLDIPQMLDAQELQDMAKPDERAVMTYVSCFYHA
FSGAQKVVSDDIRVVFLPRAETAANRILKVLGVNQENERLMDEYERLASDLLEWIARMKP
WLDDRTTDNTMEGVQRKLDDFRDYRAKQKPPKIDEKGHLEAAYNTLQTKLRLSNRPAFMP
SEGKLVSDITSAWKGLEGAEKGYEEWLLAEMRRLERLDHLAKKFYYKAGIHEKWTVGQEE
NLASEEYKRASLQELKALMKKHEAFESDLAAHQDRVEQIAAIAQELNDLDYHDTETINDR
CRDICDEWDRLGSATQKRRTALENMEQILESIEQQHLEFAKRAAPFNNWMDCAKE
Download sequence
Identical sequences H2Y434
ENSCSAVP00000000082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]