SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000002081 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000002081
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily EF-hand 2.01e-24
Family Calmodulin-like 0.0000372
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000002081   Gene: ENSCSAVG00000001221   Transcript: ENSCSAVT00000002118
Sequence length 147
Comment pep:known reftig:CSAV2.0:reftig_489:156050:157669:1 gene:ENSCSAVG00000001221 transcript:ENSCSAVT00000002118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEIKEAYEIFCRTTEMTLGYDQVGDLFRAISLNPTCEDVENALGNPSKEDMNSKTLNME
EFVPVYTKLITEFTEGTFDDILEGVRVFDKEGNGTVMGAEIRHVLRTLGEKMTTQEISAC
MDGQEDMSGTINIDTFCRYLLEEKKAE
Download sequence
Identical sequences H2Y9T1
ENSCSAVP00000002079 ENSCSAVP00000002081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]