SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000004591 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000004591
Domain Number 1 Region: 276-405
Classification Level Classification E-value
Superfamily EF-hand 3.89e-40
Family EF-hand modules in multidomain proteins 0.000012
Further Details:      
 
Domain Number 2 Region: 408-503
Classification Level Classification E-value
Superfamily EF-hand 6.35e-31
Family EF-hand modules in multidomain proteins 0.0001
Further Details:      
 
Domain Number 3 Region: 484-571
Classification Level Classification E-value
Superfamily RING/U-box 1.09e-16
Family ZZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 238-275
Classification Level Classification E-value
Superfamily WW domain 0.0000000147
Family WW domain 0.00057
Further Details:      
 
Domain Number 5 Region: 88-229
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000475
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000004591   Gene: ENSCSAVG00000002736   Transcript: ENSCSAVT00000004658
Sequence length 771
Comment pep:novel reftig:CSAV2.0:reftig_130:569665:572076:-1 gene:ENSCSAVG00000002736 transcript:ENSCSAVT00000004658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMEQWEDIASILEGLVDWLKVKNEDTNKILMQCVADATALKQFRSQHEMLDAELDAKCTV
IDKSLTAVEVIVLQHQEQTEDPEKYVQPMQLKRISELATELREVWKVTQKKSIQLKLHIN
KLLPAVEGLDAILSKCYSMLQNIERTKEDWVGVGDLPIEALQGHIKKMKIFQKDQMNPIS
ESMDELKSSISYFHDMKMQFTPATKKKIDDVNMRWKMMQIYCSERTKQLLDAARDFGPNS
QLFLTSSVEGTWERAVAENKVPYYINHKSKSTSWDHPKMVELMESMLDLNDVRFAAYRTA
MKLQRLQKALCLDLLTLDTAVQSFSQHGLSLDFDSLHTKEWVNVLEIITCLTTLYDAIEK
EHKSLVNVPLCVDMCLNWLLNVYDTKRSSKISARSFIVGIISLCSSDIEGKYNAVFRQIA
IPTGFADRTKLGDLIKDFMLIPKQLGESHAFGGSNPHASICSCFQLVGRRPEIDAGQFID
WMKLEPQSLVWLPVLHRLTSAENVSHPARCSVCRECPIVGFRYRSLRHFKHDICQSCFFS
GRVAKNNKFAYPIVEYCTPTTSSENIRDFTKILKNKLRTRANRPTKRIGYLPVKTDDKEN
DDIITDDVTIDGTIGANDAHQKIEEYAKLLANLDQQNRVQTPLDEEQECILEYCGALTQD
KTPTIFTHKEEVFTTGFTSEKYDGYSPNKGNITDRNKTKPRISSENHDEYSPNKGKGINE
GKSRLSDDGNELMVEAKLLEHHTSRIDTQMQMLEDHTESIKTQLQELKTII
Download sequence
Identical sequences H2YGZ2
ENSCSAVP00000004591 51511.ENSCSAVP00000004591 ENSCSAVP00000004591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]