SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000006249 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000006249
Domain Number 1 Region: 97-197
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000288
Family Spectrin repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000006249   Gene: ENSCSAVG00000003733   Transcript: ENSCSAVT00000006328
Sequence length 381
Comment pep:known reftig:CSAV2.0:reftig_11:384276:388480:1 gene:ENSCSAVG00000003733 transcript:ENSCSAVT00000006328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLEWDDYDISQSEIETKLASGEMTDDDSIPELSPFETRDAQIPTNQTEALLPTEPKSP
QTEKPTKRTNVVDIRDLDTDARLKKPRTSDKMSEPQRQQLNNDLNDVLAWLDKVKCDLTT
VCDCVTMRELELSLAELKELQKQIESRNPIVKSIRILATPLSRNDGEMKTKLHRLEQGWD
RVNNSANQWRETLQSCFSDSKALRTDVAKIRERSTHLDQQREDLASVVKTFDSPLSIPLA
TLRKTHKDLVQIRFEVLEDRAQVASLQEMSHQLFLVDARYRGASSPPVDAAADTCDKLND
LGGRLRALLDRVTDDIHVAESALQRERHRVRDEASSNSDLDSLTSESSLRSATPIKLKML
RRKIWKKQNLKSYPHLWMLTS
Download sequence
Identical sequences H2YLP7
ENSCSAVP00000006249 ENSCSAVP00000006249 51511.ENSCSAVP00000006249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]