SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000006706 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCSAVP00000006706
Domain Number - Region: 12-88
Classification Level Classification E-value
Superfamily Spectrin repeat 0.095
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000006706   Gene: ENSCSAVG00000004012   Transcript: ENSCSAVT00000006792
Sequence length 261
Comment pep:novel reftig:CSAV2.0:reftig_220:149217:150860:1 gene:ENSCSAVG00000004012 transcript:ENSCSAVT00000006792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LETKNKERKIPYKQNLPEVESLKRKLETADREISFTKKLNSELKEENYKLKVEFDNERVK
LLKKHDEEERNWENLKHQLLGKIEYLEEINVTSFPLHGSQVTSSSAEDQRHQRSLGELKL
GEIAEPTRYNANLQSPNVSMNLSAIPSNYEQFHTTVDAALKQIEKISEDLENINTESPSQ
SFDLAPPVTTDTAVICSDQNLISHPTMPRLENTTSDESSETTIPRDKPGEVFSMMKEDKR
KRSKSFCTRSYDDMQPVESLQ
Download sequence
Identical sequences H2YN04
51511.ENSCSAVP00000006706 ENSCSAVP00000006706 ENSCSAVP00000006706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]