SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000008227 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000008227
Domain Number 1 Region: 1-105
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.69e-18
Family Nuclear receptor ligand-binding domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000008227   Gene: ENSCSAVG00000004898   Transcript: ENSCSAVT00000008335
Sequence length 117
Comment pep:novel reftig:CSAV2.0:reftig_140:174543:175727:1 gene:ENSCSAVG00000004898 transcript:ENSCSAVT00000008335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSIFSFACSLSDMNVDISSFSCLLGLLLFREPRGLIDPKKAEEMLALSIESLKDHVTKS
SVTSDRPNLFAKLLGILPELNALGKMGSRKIHRHHIESPEVLVPQCLQRYLVSNNHL
Download sequence
Identical sequences H2YSB7
ENSCSAVP00000008227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]