SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000008400 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCSAVP00000008400
Domain Number - Region: 81-178
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0493
Family Spectrin repeat 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000008400   Gene: ENSCSAVG00000004990   Transcript: ENSCSAVT00000008509
Sequence length 263
Comment pep:novel reftig:CSAV2.0:reftig_60:129158:135284:-1 gene:ENSCSAVG00000004990 transcript:ENSCSAVT00000008509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTALSAMLDELMGKNRNAAPNDKTNEIHWSDEEICKHFLCGFCPAELFTNTRSDLGTCNK
VHDEKTKQAYQASSRYMKSGYEEDFLRFLQQCWQDVERRIRRNHQRLQLSEEKTQKVQQA
PPTGAEHDEKIAMLNDKITGMLENIERLGGEGEVEQAQSMMKLCDQLKEEREALQNQKGG
VMDPFTVQEKQMEVCEVCGAFLIVGDAQTRVDDHLMGKQHMGYAKIKATIADLKEKLQKA
SVTSMAERKRIHETANDPHPVIE
Download sequence
Identical sequences H2YSU0
ENSCSAVP00000008400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]