SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000008439 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000008439
Domain Number 1 Region: 69-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000129
Family EGF-type module 0.005
Further Details:      
 
Domain Number 2 Region: 32-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000084
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000008439
Domain Number - Region: 2-30
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0005
Family EGF-type module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000008439   Gene: ENSCSAVG00000005009   Transcript: ENSCSAVT00000008548
Sequence length 112
Comment pep:novel reftig:CSAV2.0:reftig_99:428031:431074:1 gene:ENSCSAVG00000005009 transcript:ENSCSAVT00000008548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGHGICTDSPHGPVCNCTDDTYGPRCQHNGSNPCTSYTCGNGLCSSVNAVDYECLCDAG
FTGENCEQDVNDCQSDPCFNHGICHDLINSYECDCNGTGYNGPQCNMDIDEC
Download sequence
Identical sequences H2YSX9
51511.ENSCSAVP00000008439 ENSCSAVP00000008439 ENSCSAVP00000008439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]