SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000009003 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000009003
Domain Number 1 Region: 2575-2696,2730-2845
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.07e-24
Family Nitrogenase iron protein-like 0.089
Further Details:      
 
Domain Number 2 Region: 1601-1810
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.95e-24
Family Extended AAA-ATPase domain 0.03
Further Details:      
 
Domain Number 3 Region: 2235-2502
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.11e-18
Family RecA protein-like (ATPase-domain) 0.086
Further Details:      
 
Domain Number 4 Region: 1830-2018
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.2e-17
Family ABC transporter ATPase domain-like 0.052
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000009003
Domain Number - Region: 859-952
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0384
Family Spectrin repeat 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000009003   Gene: ENSCSAVG00000005324   Transcript: ENSCSAVT00000009117
Sequence length 4271
Comment pep:known reftig:CSAV2.0:reftig_35:1134432:1193423:1 gene:ENSCSAVG00000005324 transcript:ENSCSAVT00000009117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPLAELEHWRFLMSKFNSLLEHIKGSRCKAAINTLHAAKSKVLKLWREMDAQITDHANEA
KDNVKYLYTLEKACTPLYNSDPVNMIEVIPTLVNIISMIHNISRYYNTSQRMTSLFIKVT
NQMVTACRKYITDNGQRRIWDQDSSLVKKKINVSFSISCQITHATYVFTYSKSFAMKLSH
VDLQSDKALDFSEMYIFGKFDTFCKRLNKITELLQTIETFSMLSESKIEGIDGLANKFQS
VVSNTKKKPYDILDHRKVDFDNDFENFKESIYSLECQLQTFMDSCFERVQASAQALLLLK
RFEKLKIPCLQTDIKDKYALILRTFGQEIDEIKKLYQKFRDDPPIPRDMPPIAGKIMWSR
QLFRKIEEPMQAFQEFAPELLKEKDGKALVKNYNRMGKILMEFEVLYYRAWCRETDNIKY
ALQATLLVRHPETKQLHINYDPQVPAMVRESLCMNKMGLEVPEVATNLLHKIDDLKHTKE
TLEMLLEDYDKAMESIPSIFMPLMKQHLHQVDRAVRNGLVFITWSSLNHKLYFHNVEKEL
NQLKRVIRDVNDLKEARIDDMLNDIATTALVDLEDETTYTIVDFLNCAKDHSESMAKYLN
RKSAHIEIAVYDLIQAFAKHSGRADFSFYTVPLVCSKYKDSVDFNEDDAFAVECEELVEY
FKTRTLEALLKCTRQSLDLIKRRSLVREGMAPLLVSNVELAIPNVELKPNLEEAQSAINE
TAREIGKKLSSQMTLQNSFDKLQNHYKAISEHKDITKLVMMLGSAMNNIREPVAENLIQF
NRFQMLWEEERESAVKEFMSTNPLLTEFRAEIMKYIINQRVEVLPSSISVGPLQLLPANI
KMSLVVETKSWKVSLCKCLNIEYRSKMEEVFDFINEYSKRLTRPIKDLDDIREAMNSLDT
IKHEFTRIDFTVGPVEEAYAIMQKFNVKVNPEEINKVDTLRYSWNKLLSQSNMISDKLCK
VQPQFRSDLIDKVEKFHEDSTTFQEAYDENGPMAEGISPVEASDRLQVYQSRFDDLWRKF
QTYNAGEELFGLQVTDYPALQRTKKELNLLQKLYGLYNAVMKSINGYFDILWSEGCVMYL
TLLVYISSLIQKICRKLPKGLKEWQAFNELKNKIDDFNETCPLLELMSDKAMKKRHWERI
ENLTGYTFDIENENFQLRNIMSAPLLKYKEDIEDICISAVKEKDIEAKLSVVIAEWSANV
LSFSVFKARGELLLKGQETSEIVSMLEDSLMVLGSLLSNRYNAPFKPQIQLWVQKLSNTS
DIIENWLIVQNLWVYLEAVFVGGDIAKQLPKEAKRFANIDKSWVKIMTRAHETPNVVQCC
VGDETLGQLLPHLLEQLEQCQKSLTGYLEQKRLVFPRFFFVSDPALLEILGQASDSHSIQ
SHLLGVFENVNKVDFHEKDYDRMMAVVSKEGETIMLEKQVIAKGNVEIWLGDLLREQQAS
LHSVIRDAAIQLADPGFQVHPYLETAPAQVGLLALQMLWTRDAEEALSNARYDKKIMPVT
NQRFLDLLNALIAVTTKELTKFDRIKFETLITIHVHQRDIFNDLVKMHIKTPLDFEWLKQ
SRFYFNNDTDKCLVSITDVDFSYQNEFLGCTDRLVITPLTDRCYITLGQALGMSMGGAPA
GPAGTGKTETTKDMGKALGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDL
PVLSVAAQQIYIVLQSKKDRKTSFVFTDGDNVSLNPEFGLFITMNPGYAGRQELPENLKV
QFRSVAMMVPDRQIIMRVKLASCGFVENIVLAQKFYTLYKLCEEQLTKQVHYDFGLRNIL
SVLRTLGATKRARPNDGEPTIVMRVLRDMNVSKLVDEDEPLFLSLINDLFPGIVLDSATY
EDLQAAIGLNVTEMGIVNHPPWNLKVVQLFETQRVRHGMMVLGPSGAGKTACVNMIMRAM
TECGEPHKEVRMNPKITAPQMFGRLDVATNDWTDGIFSTLWRRSHRTKKGENMWLVLDGP
VDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKILFEVSHSHYCSDLIHSVVLLPTQVF
YFPVIPFKSSFFLNISTRLSVEPKMTKFKSVKIYKRNKQYWVECNKITTLPDPFHQYVKP
FVMRNLKHIPPQALNVLEGLIPSKEEVGILPQFHVERLFIFCLMWSVGATLELADRARME
AFLIDHESNLDLPKIDAGSGHTIFEFVPDANGEWEHWSKRVVEYIYPSDSIPEYSSILVP
NVDNIRTKFLIDVIAKQNKAVLLTGEQGTGKTVLIQGYMLGFNPEIMMAKSFNFSSATEP
NMFQLTIESYVDKRMGSTYGPPAGRKMTVFIDDVNMPVINEWGDQITNEIVRQMMEMHGM
YSLEKPGDFTNIVDMQFIAAMIHPGGGRNDIPQRLKRQFNVFNCTLPSNASIDKIFGIIG
LGYFCIERGFNQDVVDIIGKLVPATRMLWQWTKVKMLPTPAKFHYIFNLRDLSRIWQGML
TVKHEECGEKADVISLFKHECTRVIADRFTNEDDKVWFENSIMRAIKEEVDEGLAAMATG
SEPYFVDFLRDAPEPTGEEGDDADLDAPKIYEQIPTLEALSEKLLSYMAQYNESVRGASM
DLVFFKDAMTHLVKISRIIRTPRGSALLVGVGGSGKQSLTKLASFIAGYKPFQITLTRTY
NAQNLMDDLKVLYRIAGGEGKGVSFIFTDNDIKEEGFLEYLNNILSSGEVSGLFARDEID
EITQGLISTMKREFPRRPPTQENLYEYFISRSRDNLHIVLCFSPIGEKFRNRALQFPGLF
SGCTMDWFTRWPRDALVAVSNHFLSKVQVVCEPEVKRQLIQTMGVFHDKVAETCVEYFDR
YRRTTHVTPKSYLSFLDGYKGIYKENHALLDDLSSLAKLLEAGESVALLSKELVVKEKDL
AVASVKADKVLKEVTVSAQAAEKVKNAVLKVKEKAQIIVDSIAVEKSAAETKLEAAEPAM
RAAEDALNTIKAADIATVRKLAKPPHLIMRIMDATLILFMRPVDKVQPDPERPTVKPSWG
EALKLMSQSGFMQSLKNFDKDSITEETVELLAPYFEMEDYSFENAKKVCGNVAGLLSWTK
AMVSFYGINKEVLPLKANLAKSEVKLAIALADLAQAQEQLDEKQRELDEVQAKFDAAMKE
KQDLLDDAESCRRKMTAATQLIEGLGGEKVRWTEQSQKFKAEILELVGNVLLATGFLSYC
GPFNQEFRNYMIKETWEKELSERKIPFVSDLNLIAMLIDAPTIGEWNLQGLPGDDLSIQN
GIIVTKATRYPLLIDPQGQGKTWIRNREKDNQLIVTTLNHKYFRTHLEDALSQGRPLLIE
DIGEELDPALDNVLEKNFIKAGSTYKVKVGDKEVDVMSGFQLYVTTKLPNPAYTPEVSAK
TSIIDFTVTMQGLEDQLLGRVILTEKNELEAEKVKLMEEVTRYKRKMKELEDNLLYKLTS
TQGSLVDDESLIEMLATTKEMALEVSEKLTIAADTEVKINTAREEFRPVAIRGSIVYFLI
VEMSMVNIMYQTSLLQFLGLFDESMAKSTKSPITSKRINNIIEFLTYTAFRYTCRGLYET
HKLLFTLLMALKIDLRKTIIRSSEFQTFIKGGAALDLKSVVAKPCKWILDITWLNLVQLQ
KLPEFREILNQIARNEKQWKAWFDTEAPEEEVIPDGYSASLDTFRKLLLIRSWCPDRIMP
QARKYIGQSLGARFSEAVILNLEETHQESTIRVPLICLLSQGSDPTDQISTLAKKKNIDC
RAISMGQGQEVHARRLVSTLMQIGGWALLQNCHLGLDFMDELLDTVQTAENVNPAFRTWI
TAEEHPKFPITLLQSSIKFTNEPPQGVKAGLTRTFAGISQDQLDVNNLPQWKPLLYAIGF
MHTAVQERRKFGPLGWNIPYEFNTSDHYATVQFLQNHLDDLDPKRGIQWSTVRYMIGGEV
QYGGRVTDDYDKHLLNTFAAVWFHEQMFTDAFCFYIGYKIPTFKTTKEVMDAIDTLPLTD
TPEVFGLHMNADITYQTNSATAILDTILNIQPKDAGGGSGETRESVVFRQAHEMLMKLPP
DYVRSKLVKMGLLNSLNIFLKQEIARMQKVITLVRITLTDLKLAIEGTIIMSENLRDALD
NLFDAKVPSLWRKVSWESSTIGFWFTELIERNSQLSHWIFDGRPTCFWMTGFFNPQGFLT
AMRQEVTRMHKGWALDTVTLHNEVLKQFREDISSSPEGVYVHGLFLDGAAWDRRNSRLQE
SQPKVLFVPLPVVHVFAINSTAPKDPSLYVCPVYKKPCRTDLTYITPLWLKTTQKPTHWT
MRGVALLCDIK
Download sequence
Identical sequences H2YUJ3
ENSCSAVP00000009003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]