SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000009202 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCSAVP00000009202
Domain Number - Region: 15-117
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0619
Family Spectrin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000009202   Gene: ENSCSAVG00000005422   Transcript: ENSCSAVT00000009319
Sequence length 270
Comment pep:novel reftig:CSAV2.0:reftig_16:790365:797532:1 gene:ENSCSAVG00000005422 transcript:ENSCSAVT00000009319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDEIKNKNLEEKHALRIQLEGAVESLWKQFQAALKNYNETTEERKIAFENLKAKDEKSA
KEIETQMRKLQRIQDTINQLRAKMQQNSRECEDRNRRLREEREHVQTHFQQLKSEMNNNR
EADRAKLTQLTLQSNSAIKKLKKVCDKGEQILRLSEMCRKLETEEEKVLPFYASSLSQEE
QEDVEAAVYESPSEPLATIMHEYTSLDNFWKRYNKVLLDKLALDKEKQILSQENQQLRNV
LKQYLDGISVNDEILSQNNPLFVVNHKTNV
Download sequence
Identical sequences H2YV42
ENSCSAVP00000009202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]