SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000009334 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000009334
Domain Number 1 Region: 2-70
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000667
Family Spectrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000009334   Gene: ENSCSAVG00000005499   Transcript: ENSCSAVT00000009451
Sequence length 70
Comment pep:novel reftig:CSAV2.0:reftig_232:11799:14079:1 gene:ENSCSAVG00000005499 transcript:ENSCSAVT00000009451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFSWKTDMVEAWIAEKERALKTDDNPTDLSSVQALIVKQETFDAGLAAFEQEGVAKITG
LKDQLVKADH
Download sequence
Identical sequences H2YVH4
51511.ENSCSAVP00000009334 ENSCSAVP00000009334 ENSCSAVP00000009334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]