SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000009582 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000009582
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.5e-49
Family Transglutaminase core 0.0000163
Further Details:      
 
Domain Number 2 Region: 122-170
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000034
Family Transglutaminase, two C-terminal domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000009582   Gene: ENSCSAVG00000005628   Transcript: ENSCSAVT00000009699
Sequence length 171
Comment pep:known reftig:CSAV2.0:reftig_1:989827:997125:1 gene:ENSCSAVG00000005628 transcript:ENSCSAVT00000009699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNCNDDTGVLWGRWDGEYSDGVRPTVWKGSVKILKEWNTTKMMPVKYGQCWVFSGLLTT
VLRAIGIPARSVTNFNSAHDTEYNMTIDKFIDKNGDEARSLSGDSIWNFHVWNECYFRRA
DLPEPIEPGETYTSPDIEVRPYRVNRTVLIADFDCNEIWNIKARKRVNVVQ
Download sequence
Identical sequences H2YW71
ENSCSAVP00000009582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]