SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000009758 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCSAVP00000009758
Domain Number - Region: 2-131
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00561
Family Spectrin repeat 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000009758   Gene: ENSCSAVG00000005725   Transcript: ENSCSAVT00000009876
Sequence length 146
Comment pep:known reftig:CSAV2.0:reftig_140:348816:350477:-1 gene:ENSCSAVG00000005725 transcript:ENSCSAVT00000009876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERLGRLESKFEETESRIDELQSKVMERDQQVALCRRECSDLKGSLASAEGELRAAKVEN
EHDVKRQQQRILELKAELEEQKLNDRNEISMLERTAQDHYERAARLSRELNNLRSEFIQA
KKEVNFLTEERSRQTMEMERMTRRIR
Download sequence
Identical sequences H2YWP7
ENSCSAVP00000009758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]