SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000012036 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000012036
Domain Number 1 Region: 164-268
Classification Level Classification E-value
Superfamily SH2 domain 3.87e-28
Family SH2 domain 0.0000233
Further Details:      
 
Domain Number 2 Region: 61-123
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000459
Family SH3-domain 0.00068
Further Details:      
 
Domain Number 3 Region: 3-60
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000564
Family SH3-domain 0.00057
Further Details:      
 
Domain Number 4 Region: 123-183
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000121
Family SH3-domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000012036   Gene: ENSCSAVG00000007078   Transcript: ENSCSAVT00000012176
Sequence length 282
Comment pep:novel reftig:CSAV2.0:reftig_16:1344890:1351411:-1 gene:ENSCSAVG00000007078 transcript:ENSCSAVT00000012176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAITIHDFTASESDELSIKKGSVVKVLSVKQEEKNWYEAEQDGKNGLVPKGYFQIYPYA
MAEREVIALYDFTASNSGDLPFKKGSTLKIFIVTQDAAWCKAEQDGKSGIVPKNYLHLKP
VKYYGGFAPKTKDAIALYDFTASAPDELSFKKGSILTITMPYLHWYKAEQDGKDGLIPKN
YFQLKPHLWYKGKIKRMVAEEILKQQKKNGQFLIRESESTPGDFSLSVRFNNAVQHFKVL
RDGAGKYFLWVVKFNSLNQLVDYHRTSSVSRSQTIYLKDMDE
Download sequence
Identical sequences H2Z374
51511.ENSCSAVP00000012036 ENSCSAVP00000012036 ENSCSAVP00000012036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]