SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000012456 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000012456
Domain Number 1 Region: 106-294
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-47
Family Nuclear receptor ligand-binding domain 0.0000134
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000012456
Domain Number - Region: 2-37
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000153
Family Nuclear receptor 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000012456   Gene: ENSCSAVG00000007313   Transcript: ENSCSAVT00000012600
Sequence length 296
Comment pep:novel reftig:CSAV2.0:reftig_17:1196036:1201525:-1 gene:ENSCSAVG00000007313 transcript:ENSCSAVT00000012600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMYTRRKCPECRLRKCRAVGMLEECLLTEIQCKSKRRSRKVKTISEDDETMDIVKLTNQ
QSPAPVVKPPPEKDETDRLAALVGKCFSVYRSNPEIVKRWECYYLEQHTKEVPNLCEIAT
AHVQVFVEYTKKLPGFMRLDSHDQIALLKGCVVQAMLLRNSCGYNRINRHLDLKRFVQDT
GLKEDNIRTLTDFFDNVAKLQMDETEYGLLIAIIVFDSDHTDRENQLTIDKYRDRYLAAL
SRYSEAREPRRPQILAKILSLLTEMRTLYHTHVKMVSDWKQREQLTPLLCEIWDMR
Download sequence
Identical sequences H2Z4E4
ENSCSAVP00000012456 ENSCSAVP00000012456 51511.ENSCSAVP00000012456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]