SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000012838 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000012838
Domain Number 1 Region: 159-251,438-490
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.18e-30
Family Canonical RBD 0.00053
Further Details:      
 
Domain Number 2 Region: 37-154
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.61e-21
Family Canonical RBD 0.0032
Further Details:      
 
Domain Number 3 Region: 506-547
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000023
Family Canonical RBD 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000012838
Domain Number - Region: 260-322
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000114
Family Pentapeptide repeats 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000012838   Gene: ENSCSAVG00000007538   Transcript: ENSCSAVT00000012987
Sequence length 549
Comment pep:known reftig:CSAV2.0:reftig_77:2730822:2746135:1 gene:ENSCSAVG00000007538 transcript:ENSCSAVT00000012987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMTVHGNQYLQHALPPVMSSTVPMAVHSESSYGGHGYLYPHVPLIPANCGSNIDRMHPF
KEAPEKDDDAVKLFIGQVPKNWDEKELRQIFAPFGEIFELSVLRDKYTGMHKGCAFLTYA
HKTAAMNAQNSLHERKTLPGMNHPIQVKPADTVSKGGKDDRKLFVGMLGKRQNEEDVRVL
FEPFGTIEECTILRTPEGQSKGCAFVKLACHSEAKTAMDALHGSQTMPGASSSLVVKFAD
TDKERAVRRMQQMAQTLNKLKLTKLSLTKLRITKLSLTKLRLTKLRLTKLRLTKLRLTKL
RLTKLRLTKPRLTKLSLTELSLTKPRLPTHRTLSQRPQVGTRSPPNQPRSTDSRKPLPSS
RSLLVMIHHQHATPVNGIPSTPQSPVAPAITTLNLLPPPSSATASTPEGSVELTQAYAQP
QPYTADFCLNLRFMLLGPEGCNLFIYHLPQEFSDADLANVFQPFGNVISAKVFIDRATNQ
SKCFGKICFCAIFVQPLALSVYSCVGIRFVSFDNAISSQAAIQTMNGFQIGMKRLKVQLK
RPKEQSRPY
Download sequence
Identical sequences H2Z5H6
ENSCSAVP00000012838 ENSCSAVP00000012838 51511.ENSCSAVP00000012838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]