SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000012839 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000012839
Domain Number 1 Region: 112-204,392-476
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.39e-41
Family Canonical RBD 0.0000293
Further Details:      
 
Domain Number 2 Region: 16-106
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.37e-21
Family Canonical RBD 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000012839
Domain Number - Region: 232-288
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00131
Family Pentapeptide repeats 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000012839   Gene: ENSCSAVG00000007538   Transcript: ENSCSAVT00000012988
Sequence length 480
Comment pep:known reftig:CSAV2.0:reftig_77:2732907:2748290:1 gene:ENSCSAVG00000007538 transcript:ENSCSAVT00000012988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNPSGSLLKISNLTEAPEKDDDAVKLFIGQVPKNWDEKELRQIFAPFGEIFELSVLRDKY
TGMHKGCAFLTYAHKTAAMNAQNSLHERKTLPGMNHPIQVKPADTVSKGGKDDRKLFVGM
LGKRQNEEDVRVLFEPFGTIEECTILRTPEGQSKGCAFVKLACHSEAKTAMDALHGSQTM
PGASSSLVVKFADTDKERAVRRMQQMAQTYGLINPVPLQIGTYSLPYTQLSLTKLRITKL
SLTKLRLTKLRLTKLRLTKLRLTKLRLTKLRLTKPRLTKLSLTELSLTKPRLPTHRTLSQ
RPQVGTRSPPNQPRSTDSRKPLPSSRSLLIPPFYGTSPRISNPLHPTVIHHQHATPVNGI
PSTPQSPVAPAITTLNLLPPPSSATASTPEGPEGCNLFIYHLPQEFSDADLANVFQPFGN
VISAKVFIDRATNQSKCFGFVSFDNAISSQAAIQTMNGFQIGMKRLKVQLKRPKEQSRPY
Download sequence
Identical sequences H2Z5H7
ENSCSAVP00000012839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]