SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000013053 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000013053
Domain Number 1 Region: 204-366
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000633
Family Spectrin repeat 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000013053
Domain Number - Region: 322-536
Classification Level Classification E-value
Superfamily Tropomyosin 0.0373
Family Tropomyosin 0.0072
Further Details:      
 
Domain Number - Region: 109-217
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0889
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000013053   Gene: ENSCSAVG00000007669   Transcript: ENSCSAVT00000013202
Sequence length 545
Comment pep:novel reftig:CSAV2.0:reftig_19:1270455:1282493:1 gene:ENSCSAVG00000007669 transcript:ENSCSAVT00000013202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RERDELQSMLSKFERHMAEIQSNVKVVTQERDKTNLLYEQSNEELQRLRHEFVRSPKSPK
ASLTAQAILRRVENDRDTAVADLRRMTTERDSLRERLKIQQEQSISERSRLEQRAEDLEA
KARALGQERIDLQSRIDSLKDVNLSQEDDIKALRLKMQQTEEDYTVVRAELDDVKALKSQ
ISSSLDVAQRNLSRKSSDLALSEDRVRTLENRISELLDAAAKQSEEAATLRATTTSLDRE
KDALQAALDERTERAAALDEHLSRRERDMSDLRVAISDLEAKLDRAGDDLASSEREVRSL
RRQLDATQTDLAEASRAKETALRENRRMQDDLSTLTRENQDINMELDDVMRDRDDLKNKV
QDHVGRISSLESSVSSKDRELHDVLDQYRKVTSERDSAESRYRVTNDESQSLRNELLSAD
SERKRLCEKISSLEREISDHMHLHSSYEDLSREVEILHKHLESERLGNKNLEELVGNARE
KEFQAQLDSQEQKSEGQLLRDKLALNESKLQSMGREVASLRDRASQLDAELEVAKRHLTN
ERYER
Download sequence
Identical sequences H2Z641
ENSCSAVP00000013053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]