SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000013353 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000013353
Domain Number 1 Region: 149-293
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.67e-46
Family Nuclear receptor ligand-binding domain 0.000000659
Further Details:      
 
Domain Number 2 Region: 1-62
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.63e-19
Family Nuclear receptor 0.0000682
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000013353   Gene: ENSCSAVG00000007831   Transcript: ENSCSAVT00000013504
Sequence length 294
Comment pep:known reftig:CSAV2.0:reftig_140:873021:877237:-1 gene:ENSCSAVG00000007831 transcript:ENSCSAVT00000013504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CEGCKGFFKRTVRKFLTYTCRDDKDCIIDKRQRNRCQYCRYQKCTAMGMKKEAVQEERQK
NRDQDEVIGDTSHDDMPVDKILQAELASDPKLEELISMQEVIYIKEIMVYSSYIMIACWV
YRSYFHHLLMKECVKRKVSKSNSCKVKFVVPIDASVCKAADHQLFTLVEWAKRVPMFTTL
PLDDQVTLLRAGWNELLIASFSHRSIEISDGIILASGLRVYRQTAHSAGVGAIFDRVLTE
LIAKMRDMAMDRTELGCLRSIVLFNPDAKELTDAAYIETLREKVYASLEVYCKS
Download sequence
Identical sequences H2Z6Z1
ENSCSAVP00000013353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]