SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000013358 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000013358
Domain Number 1 Region: 136-205
Classification Level Classification E-value
Superfamily GAS2 domain-like 7.85e-23
Family GAS2 domain 0.00058
Further Details:      
 
Domain Number 2 Region: 47-127
Classification Level Classification E-value
Superfamily EF-hand 1.86e-17
Family Polcalcin 0.057
Further Details:      
 
Weak hits

Sequence:  ENSCSAVP00000013358
Domain Number - Region: 4-64
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0152
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000013358   Gene: ENSCSAVG00000007835   Transcript: ENSCSAVT00000013509
Sequence length 206
Comment pep:novel reftig:CSAV2.0:reftig_2:1943202:1947590:1 gene:ENSCSAVG00000007835 transcript:ENSCSAVT00000013509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVMCENLHAQWQRVWLSAIERQRKLQEAGDAARRELELSDFLFDAWRKRYMKWMKHKKS
RVMDFFRAMDTDGDGKVTRQQFIDGIIKSKFPTDEMEMSKVADIFDRDGDGYIDYYEFVA
ALYPTKESYKPVTDADKIEDEVVRQVSRCTCVKRFQVQQIAENKYRFGDNQQLRLVRILR
STVMVRVGGGWMALDEFLLKNDPCRG
Download sequence
Identical sequences H2Z6Z6
ENSCSAVP00000013358 51511.ENSCSAVP00000013358 ENSCSAVP00000013358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]