SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000014470 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCSAVP00000014470
Domain Number 1 Region: 3-121
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-33
Family Nuclear receptor ligand-binding domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000014470   Gene: ENSCSAVG00000008468   Transcript: ENSCSAVT00000014635
Sequence length 129
Comment pep:novel reftig:CSAV2.0:reftig_0:1257582:1259214:1 gene:ENSCSAVG00000008468 transcript:ENSCSAVT00000014635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVDQIVLLRGGCLEMLVLRSYFAFSCDENKYMSDKFQYQPSDFLQAGCSEEFVEKYNSLH
LRMRKMKLQVEEICLLLALVLFSPDRPGLEEQAKVEEMQDMVANTLQAYEYTNKPPKEAR
VCLCWVIYR
Download sequence
Identical sequences H2ZA55
ENSCSAVP00000014470 51511.ENSCSAVP00000014470 ENSCSAVP00000014470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]