SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCSAVP00000014891 from Ciona savignyi 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCSAVP00000014891
Domain Number - Region: 246-304
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0822
Family Spectrin repeat 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCSAVP00000014891   Gene: ENSCSAVG00000008718   Transcript: ENSCSAVT00000015065
Sequence length 319
Comment pep:novel reftig:CSAV2.0:reftig_0:1360974:1364630:1 gene:ENSCSAVG00000008718 transcript:ENSCSAVT00000015065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKISNFDVANIQLKSIPSHAELVKLTNMMITFVGMPSMPDVDISSLVARYVGQLNLPLEI
IVFTNHLLKVDNYKYTRSTTKKESYMPDIVAISFIVVSLKLLFGLNDDYEWSLNEASKND
AEYPTHDCQHFKWKTWVRYHLKRRQMRIQNPKTIFDAKDAEAVMDLHSYYEHWDSVVLNA
HLSSKEKAGGRKSTKYRLEMIEMRKWALQKLCDRQGSTEQIERSFILRQNAQVFPSPSEE
ENMTNNCICHAIQMLKDGSLGYSLIDSNPHKRHNKHQTGESDLSVHSDSYNFLLSLAHEL
TTACKQTIHTKIYDIEKLL
Download sequence
Identical sequences H2ZBC6
51511.ENSCSAVP00000014891 ENSCSAVP00000014891 ENSCSAVP00000014891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]